OLFM3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17293
Additional Names:: B230206G02Rik|OLFM3
Application:: ELISA, WB
Molecular Weight:: 53kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: HQRVLSLETRLRDCMKKLTCGKLMKITGPITVKTSGTRFGAWMTDPLASEKNNRVWYMDSYTNNKIVREYKSIADFVSGAESRTYNLPFKWAGTNHVVYNG
Synonyms:: B230206G02Rik;noelin-3;opti;optimedin
Extra Details:: Predicted to be involved in eye photoreceptor cell development. Located in Golgi apparatus and extracellular space. Part of AMPA glutamate receptor complex. Is expressed in brain; eye; and head. Orthologous to human OLFM3 (olfactomedin 3).