A1727
PLGF Rabbit polyclonal antibody

Size
POA
- SKU:
- A1727
- Additional Names:
- D12S1900|PGFL|PIGF|PLGF|PlGF-2|SHGC-10760
- Application:
- ELISA, WB
- Molecular Weight:
- 25 kDa/50 kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
- Uniprot:
- P49763
- Synonyms:
- D12S1900;PGFL;PIGF;placenta growth factor;placental growth factor, vascular endothelial growth factor-related protein;PLGF;PlGF-2;SHGC-10760
- Extra Details:
- Enables growth factor activity. Involved in positive regulation of cell population proliferation. Predicted to be located in extracellular region. Predicted to be active in extracellular space. Implicated in several diseases, including brain ischemia; diabetic neuropathy; glioblastoma; myocardial infarction; and pancreatic endocrine carcinoma. Biomarker of several diseases, including artery disease (multiple); autoimmune disease of musculoskeletal system (multiple); epilepsy (multiple); limited scleroderma; and pancreatic endocrine carcinoma.
- Shipping Conditions:
- Blue Ice



