A17247
PRKCDBP Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17247
- Additional Names:
- cavin-3|HSRBC|PRKCDBP|SRBC
- Application:
- ELISA, WB
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- SNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARGKLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEA
- Uniprot:
- Q969G5
- Synonyms:
- caveolae-associated protein 3;cavin-3;HSRBC;PRKCDBP;protein kinase C delta binding protein;Protein kinase C delta-binding protein;sdr-related gene product that binds to c-kinase;serum deprivation response factor-related gene product that binds to C-kinase;SRBC
- Extra Details:
- The protein encoded by this gene was identified as a binding protein of the protein kinase C, delta (PRKCD). The expression of this gene in cultured cell lines is strongly induced by serum starvation. The expression of this protein was found to be down-regulated in various cancer cell lines, suggesting the possible tumor suppressor function of this protein.
- Shipping Conditions:
- Blue Ice