ZCCHC3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17235
Additional Names:: C20orf99|ZCCHC3
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 43kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: SFRSAEKLALFLRVYEEKREQEDCWENFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTC
Uniprot:: Q9NUD5
Synonyms:: C20orf99;zinc finger CCHC domain-containing protein 3;zinc finger, CCHC domain containing 3
Extra Details:: Enables double-stranded DNA binding activity. Involved in several processes, including cellular response to exogenous dsRNA; detection of virus; and positive regulation of RIG-I signaling pathway. Located in cytoplasm.