A17219
TMX1 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17219
- Additional Names:
- PDIA11|TMX|TMX1|TXNDC|TXNDC1
- Application:
- ELISA, WB
- Molecular Weight:
- 35kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- KRRRPQPYPYPSKKLLSESAQPLKKVEEEQEADEEDVSEEEAESKEGTNKDFPQNAIRQRSLGPSLATDKS
- Uniprot:
- Q9H3N1
- Synonyms:
- PDIA11;protein disulfide isomerase family A, member 11;thioredoxin domain containing 1;thioredoxin domain-containing protein 1;thioredoxin-related transmembrane protein 1;TMX;transmembrane Trx-related protein;TXNDC;TXNDC1
- Extra Details:
- This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, and one transmembrane domain. Unlike most members of this gene family, it lacks a C-terminal ER-retention sequence. The mature membrane-bound protein can both oxidize and reduce disulfide bonds and acts selectively on membrane-associated polypeptides.
- Shipping Conditions:
- Blue Ice