A17218
TAS1R2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17218
- Additional Names:
- GPR71|T1R2|TAS1R2|TR2
- Application:
- ELISA, WB
- Molecular Weight:
- 95kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- IVQWQWDRSQNPFQSVASYYPLQRQLKNIQDISWHTINNTIPMSMCSKRCQSGQKKKPVGIHVCCFECIDCLPGTFLNHTEDEYECQACPNNEWSYQSETS
- Uniprot:
- Q8TE23
- Synonyms:
- G-protein coupled receptor 71;GPR71;sweet taste receptor T1R2;T1R2;taste receptor type 1 member 2;taste receptor, type 1, member 2;TR2
- Extra Details:
- Contributes to sweet taste receptor activity. Involved in detection of chemical stimulus involved in sensory perception of sweet taste and positive regulation of cytokinesis. Part of sweet taste receptor complex.
- Shipping Conditions:
- Blue Ice