CELA2A Rabbit polyclonal antibody

Size

£152.00

SKU:: A17200
Additional Names:: AOMS4|CELA2A|ELA2A|PE-1
Application:: ELISA, WB, IF
Molecular Weight:: 29kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: TYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLPPAGTILP
Uniprot:: P08217
Synonyms:: AOMS4;chymotrypsin like elastase family member 2A;chymotrypsin-like elastase family member 2A;ELA2A;elastase 2A;Elastase-2A;pancreatic elastase 2;pancreatic elastase IIA;PE-1
Extra Details:: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase 2A is secreted from the pancreas as a zymogen. In other species, elastase 2A has been shown to preferentially cleave proteins after leucine, methionine, and phenylalanine residues.