A17195
RHOU Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17195
- Additional Names:
- ARHU|CDC42L1|G28K|hG28K|RHOU|WRCH1
- Application:
- ELISA, WB
- Molecular Weight:
- 28kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- GRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQ
- Uniprot:
- Q7L0Q8
- Synonyms:
- 2310026M05Rik;ARHU;CDC42-like GTPase 1;CDC42L1;G28K;GTP-binding protein like 1;GTP-binding protein SB128;GTP-binding protein-like 1;hG28K;ras homolog gene family, member U;ras-like gene family member U;rho GTPase-like protein ARHU;rho-related GTP-binding protein RhoU;Ryu GTPase;wnt-1 responsive Cdc42 homolog 1;WRCH1
- Extra Details:
- This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cytoskeletal organization, and cell proliferation. A non-coding transcript variant of this gene results from naturally occurring read-through transcription between this locus and the neighboring DUSP5P (dual specificity phosphatase 5 pseudogene) locus.
- Shipping Conditions:
- Blue Ice

