PPP4R3B Rabbit polyclonal antibody

Size

£152.00

SKU:: A17189
Additional Names:: FLFL2|PP4R3B|PPP4R3B|PSY2|SMEK2|smk1
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 97kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: YKALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVGLVDYPDDEEEDEEEESSPRKRPRLGS
Uniprot:: Q5MIZ7
Synonyms:: FLFL2;PP4R3B;PSY2;serine/threonine-protein phosphatase 4 regulatory subunit 3B;SMEK homolog 2;SMEK homolog 2, suppressor of mek1;SMEK2;smk1
Extra Details:: Predicted to act upstream of or within positive regulation of gluconeogenesis and protein dephosphorylation. Located in centrosome and nuclear speck.