VGLUT1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17188
Additional Names:: BNPI|SLC17A7|VGLUT1
Application:: ELISA, WB, IF
Molecular Weight:: 55kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGG
Uniprot:: Q9P2U7
Synonyms:: BNPI;brain-specific Na-dependent inorganic phosphate cotransporter;brain-specific Na(+)-dependent inorganic phosphate cotransporter;solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7;solute carrier family 17 (vesicular glutamate transporter), member 7;Solute carrier family 17 member 7;vesicular glutamate transporter 1;VGLUT1
Extra Details:: The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in glutamate transport. The protein shares 82% identity with the differentiation-associated Na-dependent inorganic phosphate cotransporter and they appear to form a distinct class within the Na+/Pi cotransporter family.