UGT1A6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17166
Additional Names:: GNT1|HLUGP|HLUGP1|hUG-BR1|UDPGT|UDPGT 1-6|UGT-1A|UGT-1C|UGT-1E|UGT-1F|UGT1|UGT1-01|UGT1-03|UGT1-05|UGT1-06|UGT1.1|UGT1.3|UGT1.5|UGT1.6|UGT1A|UGT1A1|UGT1A3|UGT1A5|UGT1A6|UGT1A6S|UGT1C|UGT1E|UGT1F
Application:: ELISA, WB, IF
Molecular Weight:: 70kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: LLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLYFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKFSDHMTFSQRVANFLVNLLEPYLFYCLFSKYEELASAVLKRDVDIITLYQKVSVWLLRYDFVLEYPRPVMPN
Uniprot:: P19224
Synonyms:: Bilirubin-specific UDPGT isozyme 1;GNT1;HLUGP;HLUGP1;hUG-BR1;phenol-metabolizing UDP-glucuronosyltransferase;UDP glucuronosyltransferase 1 family, polypeptide A6;UDP glycosyltransferase 1 family, polypeptide A6;UDP-glucuronosyltransferase 1 family polypeptide A6s;UDP-glucuronosyltransferase 1-1;UDP-glucuronosyltransferase 1-3;UDP-glucuronosyltransferase 1-5;UDP-glucuronosyltransferase 1-6;UDP-glucuronosyltransferase 1-A;UDP-glucuronosyltransferase 1-C;UDP-glucuronosyltransferase 1-E;UDP-glucuronosyltransferase 1-F;UDP-glucuronosyltransferase 1A1;UDP-glucuronosyltransferase 1A3;UDP-glucuronosyltransferase 1A5;UDP-glucuronosyltransferase 1A6;UDPGT;UDPGT 1-6;UGT-1A;UGT-1C;UGT-1E;UGT-1F;UGT1;UGT1-01;UGT1-03;UGT1-05;UGT1-06;UGT1.1;UGT1.3;UGT1.5;UGT1.6;UGT1A;UGT1A1;UGT1A3;UGT1A5;UGT1A6S;UGT1C;UGT1E;UGT1F
Extra Details:: This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenolic and planar compounds. Alternative splicing in the unique 5' end of this gene results in two transcript variants.

Shipping Conditions:: Blue Ice