RAPGEF6 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17161
Additional Names:: KIA001LB|PDZ-GEF2|PDZGEF2|RA-GEF-2|RAGEF2|RAPGEF6
Application:: ELISA, WB
Molecular Weight:: 179kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: INYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI
Uniprot:: Q8TEU7
Synonyms:: KIA001LB;PDZ domain containing guanine nucleotide exchange factor (GEF) 2;PDZ domain-containing guanine nucleotide exchange factor 2;PDZ domain-containing guanine nucleotide exchange factor I;PDZ-GEF2;PDZGEF2;RA-GEF-2;RAGEF2;Rap guanine nucleotide exchange factor (GEF) 6;rap guanine nucleotide exchange factor 6
Extra Details:: Enables several functions, including GTP-dependent protein binding activity; guanyl-nucleotide exchange factor activity; and phosphatidic acid binding activity. Involved in microvillus assembly; positive regulation of GTPase activity; and protein localization to plasma membrane. Located in several cellular components, including apical plasma membrane; centrosome; and endocytic vesicle.