HSD17B7 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17157
Additional Names:: HSD17B7|PRAP|SDR37C1
Application:: ELISA, WB, IHC-P
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: SRKVIHMFSTAEGLLTQGDKITADGLQEVFETNVFGHFILIRELEPLLCHSDNPSQLIWTSSRSARKSNFSLEDFQHSKGKEPYSSSKYAT
Uniprot:: P56937
Synonyms:: 17 beta-hydroxysteroid dehydrogenase type VII;17-beta-HSD 7;17-beta-hydroxysteroid dehydrogenase 7;17beta hydroxysteroid dehydrogenase;3-keto-steroid reductase;3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7;dihydrotestosterone oxidoreductase;estradiol 17-beta-dehydrogenase 7;PRAP;SDR37C1;short chain dehydrogenase/reductase family 37C member 1
Extra Details:: HSD17B7 encodes an enzyme that functions both as a 17-beta-hydroxysteroid dehydrogenase (EC 1.1.1.62) in the biosynthesis of sex steroids and as a 3-ketosteroid reductase (EC 1.1.1.270) in the biosynthesis of cholesterol (Marijanovic et al., 2003 [PubMed 12829805]).