TMX2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17148
Additional Names:: CGI-31|NEDMCMS|PDIA12|PIG26|TMX2|TXNDC14
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 38kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: KPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Uniprot:: Q9Y320
Synonyms:: cell proliferation-inducing gene 26 protein;CGI-31;growth-inhibiting gene 11;NEDMCMS;PDIA12;PIG26;protein disulfide isomerase family A, member 12;thioredoxin domain-containing protein 14;thioredoxin-related transmembrane protein 2;TXNDC14
Extra Details:: This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines.