CPSF1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17144
Additional Names:: CPSF1|CPSF160|HSU37012|MYP27|P/cl.18
Application:: ELISA, WB
Molecular Weight:: 170kDa/185kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: LYRDLSGMFTTESRLGGARDELGGRSGPEAEGLGSETSPTVDDEEEMLYGDSGSLFSPSKEEARRSSQPPADRDPAPFRAEPTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEARREEATRQGELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFKKVPHNINFREKKPKPSKKKAEGGGAEEGAGARGRVARFRYFEDIYGYSGVFICGPSP
Uniprot:: Q10570
Synonyms:: cleavage and polyadenylation specific factor 1, 160kDa;cleavage and polyadenylation specificity factor 160 kDa subunit;cleavage and polyadenylation specificity factor subunit 1;CPSF 160 kDa subunit;CPSF160;HSU37012;MYP27;P/cl.18;polyadenylation specificity factor
Extra Details:: Cleavage and polyadenylation specificity factor (CPSF) is a multisubunit complex that plays a central role in 3-prime processing of pre-mRNAs. CPSF recognizes the AAUAAA signal in the pre-mRNA and interacts with other proteins to facilitate both RNA cleavage and poly(A) synthesis. CPSF1 is the largest subunit of the CPSF complex (Murthy and Manley, 1995 [PubMed 7590244]).