DKK3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17139
Additional Names:: CRRL|DKK3|REIC|RIG
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: APAPTATSAPVKPGPALSYPQEEATLNEMFREVEELMEDTQHKLRSAVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNNTIHVHREIHKITNNQTGQMVFSETVITSVGDEEGRRSHECIIDEDCGPSMYCQFASFQYTCQPCRGQRMLCTRDSECCGDQLCVWGHCTKMAT
Uniprot:: Q9UBP4
Synonyms:: dickkopf 3 homolog;dickkopf homolog 3;dickkopf-3;dickkopf-related protein 3;dkk-3;hDkk-3;regulated in glioma;REIC;RIG;RIG-like 5-6;RIG-like 7-1
Extra Details:: This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Alternative splicing results in multiple transcript variants encoding the same protein.