PUMA Rabbit polyclonal antibody

Size

£152.00

SKU:: A17138
Additional Names:: JFY-1|JFY1|PUMA
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 20kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: PGALAGGPTQAAPGVRGEEEQWAREIGAQLRRMADDLNAQYERRRQEEQQRHRPSPWRVLYNLIMGLLPLPRGHRAPEMEPN
Uniprot:: Q96PG8, Q9BXH1
Synonyms:: bcl-2-binding component 3;JFY-1;JFY1;p53 up-regulated modulator of apoptosis;p53-upregulated modulator of apoptosis;PUMA
Extra Details:: This gene encodes a member of the BCL-2 family of proteins. This family member belongs to the BH3-only pro-apoptotic subclass. The protein cooperates with direct activator proteins to induce mitochondrial outer membrane permeabilization and apoptosis. It can bind to anti-apoptotic Bcl-2 family members to induce mitochondrial dysfunction and caspase activation. Because of its pro-apoptotic role, this gene is a potential drug target for cancer therapy and for tissue injury. Alternative splicing results in multiple transcript variants.