A1710
P2RY12 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A1710
- Additional Names:
- ADPG-R|BDPLT8|HORK3|P2RY12|P2T(AC)|P2Y(12)R|P2Y(AC)|P2Y(ADP)|P2Y(cyc)|P2Y12|SP1999
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 45kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- AVFFICFVPFHFARIPYTLSQTRDVFDCTAENTLFYVKESTLWLTSLNACLDPFIYFFLCKSFRNSLISMLKCPNSATSLSQDNRKKEQDGGDPNEETPM
- Uniprot:
- Q9H244
- Synonyms:
- ADP-glucose receptor;ADPG-R;BDPLT8;G-protein coupled receptor SP1999;Gi-coupled ADP receptor HORK3;HORK3;P2T(AC);P2Y purinoceptor 12;P2Y(12)R;P2Y(AC);P2Y(ADP);P2Y(cyc);P2Y12;P2Y12 platelet ADP receptor;purinergic receptor P2RY12;purinergic receptor P2Y, G-protein coupled, 12;putative G-protein coupled receptor;SP1999
- Extra Details:
- The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelet aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders. Mutations in this gene are implicated in bleeding disorder, platelet type 8 (BDPLT8). Alternative splicing results in multiple transcript variants of this gene.
- Shipping Conditions:
- Blue Ice