A17086
RPP40 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17086
- Additional Names:
- bA428J1.3|RNASEP1|RPP40
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- LSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEV
- Uniprot:
- O75818
- Synonyms:
- bA428J1.3;ribonuclease P (40 kD);ribonuclease P protein subunit p40;ribonuclease P, 40kD subunit;ribonuclease P/MRP 40kDa subunit;ribonuclease P1;RNase P subunit 1;RNaseP protein p40;RNASEP1
- Extra Details:
- Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Part of multimeric ribonuclease P complex.
- Shipping Conditions:
- Blue Ice

