[KO Validated] VAT1 Rabbit polyclonal antibody

Size

POA

SKU:: A17077
Additional Names:: T1|VATI
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 42kda
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: GVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA
Uniprot:: Q99536
Synonyms:: membrane protein of cholinergic synaptic vesicles;synaptic vesicle membrane protein VAT-1 homolog;VATI;vesicle amine transport protein 1 homolog (T. californica)
Extra Details:: Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.