Complement factor B (CFB) Rabbit polyclonal antibody

Size

£152.00

SKU:: A1706
Additional Names:: AHUS4|ARMD14|BF|BFD|CFAB|CFBD|Complement factor B (CFB)|FB|FBI12|GBG|H2-Bf|PBF2
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 100kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: TPWSLARPQGSCSLEGVEIKGGSFRLLQEGQALEYVCPSGFYPYPVQTRTCRSTGSWSTLKTQDQKTVRKAECRAIHCPRPHDFENGEYWPRSPYYNVSDEISFHCYDGYTLRGSANRTCQVNGRWSGQTAICDNGAGYCSNPGIPIGTRKVGSQYRLEDSVTYHCSRGLTLRGSQRRTCQEGGSWSGTEPSCQDSFMYDTPQEVAEAFLSSLTETIEGVDAEDGHGPGEQQKR
Uniprot:: P00751
Synonyms:: AHUS4;ARMD14;B-factor, properdin;BF;BFD;C3 proaccelerator;C3 proactivator;C3/C5 convertase;CFAB;CFBD;complement factor B;FB;FBI12;GBG;Glycine-rich beta glycoprotein;glycine-rich beta-glycoprotein;H2-Bf;PBF2;properdin factor B
Extra Details:: This gene encodes complement factor B, a component of the alternative pathway of complement activation. Factor B circulates in the blood as a single chain polypeptide. Upon activation of the alternative pathway, it is cleaved by complement factor D yielding the noncatalytic chain Ba and the catalytic subunit Bb. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. This gene localizes to the major histocompatibility complex (MHC) class III region on chromosome 6. This cluster includes several genes involved in regulation of the immune reaction. Polymorphisms in this gene are associated with a reduced risk of age-related macular degeneration. The polyadenylation site of this gene is 421 bp from the 5' end of the gene for complement component 2.

Shipping Conditions:: Blue Ice