LY86 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17051
Additional Names:: dJ80N2.1|LY86|MD-1|MD1|MMD-1
Application:: ELISA, WB
Molecular Weight:: 18kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: DFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRS
Uniprot:: O95711
Synonyms:: dJ80N2.1;ly-86;lymphocyte antigen 86;MD-1;MD-1, RP105-associated;MD1;MMD-1;protein MD-1
Extra Details:: Acts upstream of or within positive regulation of lipopolysaccharide-mediated signaling pathway. Predicted to be located in extracellular space.