TAOK2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17048
Additional Names:: MAP3K17|PSK|PSK1|PSK1-BETA|TAO1|TAO2|Tao2beta|TAOK2
Application:: ELISA, WB
Molecular Weight:: 138kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: AEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQ
Uniprot:: Q9UL54
Synonyms:: hKFC-C;kinase from chicken homolog C;MAP3K17;prostate derived STE20-like kinase PSK;prostate-derived STE20-like kinase 1;prostate-derived sterile 20-like kinase 1;PSK;PSK-1;PSK1;PSK1-BETA;serine/threonine-protein kinase TAO2;TAO1;TAO2;thousand and one amino acid protein kinase 2
Extra Details:: Enables mitogen-activated protein kinase kinase binding activity; neuropilin binding activity; and protein serine/threonine kinase activity. Involved in several processes, including focal adhesion assembly; intracellular signal transduction; and positive regulation of JNK cascade. Located in cytoplasmic vesicle; cytosol; and nuclear lumen. Part of receptor complex.