A17040
EIF2S2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17040
- Additional Names:
- eIF-2-beta|EIF2|EIF2B|EIF2beta|EIF2S2|PPP1R67
- Application:
- ELISA, WB
- Molecular Weight:
- 38kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYT
- Uniprot:
- P20042
- Synonyms:
- eIF-2-beta;EIF2;EIF2B;EIF2beta;eukaryotic translation initiation factor 2 subunit 2;Eukaryotic translation initiation factor 2 subunit beta;eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa;PPP1R67;protein phosphatase 1, regulatory subunit 67
- Extra Details:
- Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice