A17028
Beclin 1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A17028
- Additional Names:
- ATG6|Beclin 1|beclin1|VPS30
- Application:
- ELISA, WB
- Molecular Weight:
- 60kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- LKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG
- Uniprot:
- Q14457
- Synonyms:
- ATG6;ATG6 autophagy related 6 homolog;beclin 1 (coiled-coil, moesin-like BCL2-interacting protein);beclin 1, autophagy related;beclin-1;beclin1;coiled-coil myosin-like BCL2-interacting protein;Protein GT197;testis secretory sperm-binding protein Li 215e;VPS30
- Extra Details:
- This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

