Histone H4 Rabbit polyclonal antibody

Size

£152.00

SKU:: A17024
Additional Names:: H4-16|H4C11|H4C12|H4C13|H4C14|H4C15|H4C16|H4C2|H4C3|H4C4|H4C5|H4C6|H4C8|H4C9|H4FA|HIST1H4A|Histone H4
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 11 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Uniprot:: P62805
Synonyms:: dJ160A22.1;dJ160A22.2;dJ221C16.1;dJ221C16.9;FO108;H4;H4 histone family, member A;H4 histone family, member B;H4 histone family, member C;H4 histone family, member D;H4 histone family, member E;H4 histone family, member G;H4 histone family, member H;H4 histone family, member I;H4 histone family, member J;H4 histone family, member K;H4 histone family, member M;H4 histone family, member N;H4 histone, family 2;H4-16;H4.k;H4/b;H4/c;H4/d;H4/e;H4/g;H4/h;H4/I;H4/j;H4/k;H4/m;H4/n;H4/o;H4/p;H4C1;H4C11;H4C12;H4C13;H4C14;H4C15;H4C2;H4C3;H4C4;H4C5;H4C6;H4C8;H4C9;H4F2;H4F2iii;H4F2iv;H4FA;H4FB;H4FC;H4FD;H4FE;H4FG;H4FH;H4FI;H4FJ;H4FK;H4FM;H4FN;H4M;HIST1H4A;HIST1H4B;HIST1H4C;HIST1H4D;HIST1H4E;HIST1H4F;HIST1H4H;HIST1H4I;HIST1H4J;HIST1H4K;HIST1H4L;HIST2H4;HIST2H4A;HIST2H4B;HIST4H4;histone 1, H4a;histone 1, H4b;histone 1, H4c;histone 1, H4d;histone 1, H4e;histone 1, H4f;histone 1, H4h;histone 1, H4i;histone 1, H4j;histone 1, H4k;histone 1, H4l;histone 2, H4a;histone 2, H4b;Histone 4 family, member M;histone 4, H4;histone cluster 1 H4 family member a;histone cluster 1 H4 family member b;histone cluster 1 H4 family member c;histone cluster 1 H4 family member d;histone cluster 1 H4 family member e;histone cluster 1 H4 family member f;histone cluster 1 H4 family member h;histone cluster 1 H4 family member i;histone cluster 1 H4 family member j;histone cluster 1 H4 family member k;histone cluster 1 H4 family member l;histone cluster 1, H4a;histone cluster 1, H4b;histone cluster 1, H4c;histone cluster 1, H4d;histone cluster 1, H4e;histone cluster 1, H4f;histone cluster 1, H4h;histone cluster 1, H4i;histone cluster 1, H4j;histone cluster 1, H4k;histone cluster 1, H4l;histone cluster 2 H4 family member a;histone cluster 2 H4 family member b;histone cluster 2, H4a;histone cluster 2, H4b;histone cluster 4 H4;histone family member;histone H4;histone IV, family 2
Extra Details:: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H4 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the large histone gene cluster on chromosome 6.

Shipping Conditions:: Blue Ice