A17016
SLC25A16 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A17016
- Additional Names:
- D10S105E|GDA|GDC|HGT.1|hML7|ML7|SLC25A16
- Application:
- ELISA, WB
- Molecular Weight:
- 36kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- APYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL
- Uniprot:
- P16260
- Synonyms:
- D10S105E;GDA;GDC;Graves disease autoantigen;graves disease carrier protein;HGT.1;hML7;mitochondrial solute carrier protein homolog;ML7;solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16;Solute carrier family 25 member 16
- Extra Details:
- This gene encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has a possible role in Graves' disease.
- Shipping Conditions:
- Blue Ice