A16973
SFSWAP Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16973
- Additional Names:
- SFRS8|SFSWAP|SWAP
- Application:
- ELISA, WB
- Molecular Weight:
- 150kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- SKQREKNEAENLEENEEPFVAPLGLSVPSDVELPPTAKMHAIIERTASFVCRQGAQFEIMLKAKQARNSQFDFLRFDHYLNPYYKFIQKAMKEGRYTVLAENKSDEKKKSG
- Uniprot:
- Q12872
- Synonyms:
- SFRS8;splicing factor SWAP homolog;Splicing factor, arginine/serine-rich 8;splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot homolog, Drosophila);splicing factor, arginine/serine-rich 8 (suppressor-of-white-apricot, Drosophila homolog);splicing factor, suppressor of white-apricot family;splicing factor, suppressor of white-apricot homolog;suppressor of white apricot protein homolog;SWAP
- Extra Details:
- This gene encodes a human homolog of Drosophila splicing regulatory protein. This gene autoregulates its expression by control of splicing of its first two introns. In addition, it also regulates the splicing of fibronectin and CD45 genes. Two transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice