A16972
CCL19 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16972
- Additional Names:
- CCL19|CKb11|ELC|MIP-3b|MIP3B|SCYA19
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 15 kDa(N-terminal protein)
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKR
- Uniprot:
- Q99731
- Synonyms:
- beta chemokine exodus-3;Beta-chemokine exodus-3;C-C motif chemokine 19;CC chemokine ligand 19;chemokine (C-C motif) ligand 19;CK beta-11;CKb11;EBI1-ligand chemokine;ELC;epstein-Barr virus-induced molecule 1 ligand chemokine;exodus-3;Macrophage inflammatory protein 3 beta;macrophage inflammatory protein 3-beta;MIP-3-beta;MIP-3b;MIP3B;SCYA19;small inducible cytokine subfamily A (Cys-Cys), member 19;small-inducible cytokine A19
- Extra Details:
- This antimicrobial gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene may play a role in normal lymphocyte recirculation and homing. It also plays an important role in trafficking of T cells in thymus, and in T cell and B cell migration to secondary lymphoid organs. It specifically binds to chemokine receptor CCR7.
- Shipping Conditions:
- Blue Ice