HB-EGF Rabbit polyclonal antibody

Size

£152.00

SKU:: A1695
Additional Names:: DTR|DTS|DTSF|HB-EGF|HEGFL
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 23kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHT
Uniprot:: Q99075
Synonyms:: diphtheria toxin receptor (heparin-binding EGF-like growth factor);diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor);DTR;DTS;DTSF;HEGFL;heparin-binding epidermal growth factor;proheparin-binding EGF-like growth factor
Extra Details:: Enables growth factor activity and heparin binding activity. Involved in several processes, including epidermal growth factor receptor signaling pathway; positive regulation of protein kinase B signaling; and positive regulation of wound healing. Located in cell surface and extracellular space. Implicated in glomerulosclerosis and perinatal necrotizing enterocolitis.