A16949
PEX10 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16949
- Additional Names:
- NALD|PBD6A|PBD6B|PEX10|RNF69
- Application:
- ELISA, WB
- Molecular Weight:
- 37kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- EVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRAL
- Uniprot:
- O60683
- Synonyms:
- NALD;PBD6A;PBD6B;peroxin 10;Peroxin-10;Peroxisomal biogenesis factor 10;peroxisome assembly protein 10;peroxisome biogenesis factor 10;RING finger protein 69;RNF69
- Extra Details:
- This gene encodes a protein involved in import of peroxisomal matrix proteins. This protein localizes to the peroxisomal membrane. Mutations in this gene result in phenotypes within the Zellweger spectrum of peroxisomal biogenesis disorders, ranging from neonatal adrenoleukodystrophy to Zellweger syndrome. Alternative splicing results in two transcript variants encoding different isoforms.
- Shipping Conditions:
- Blue Ice