A16942
PAK3 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16942
- Additional Names:
- ARA|beta-PAK|bPAK|MRX30|MRX47|OPHN3|PAK-3|PAK3|PAK3beta|XLID30
- Application:
- ELISA, WB, IF, ICC
- Molecular Weight:
- 80kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWAR
- Uniprot:
- O75914
- Synonyms:
- adriamycin resistance-associated;ARA;beta-PAK;bPAK;MRX30;MRX47;oligophrenin-3;OPHN3;p21 (CDKN1A)-activated kinase 3;p21 protein (Cdc42/Rac)-activated kinase 3;p21-activated kinase 3;PAK-3;PAK3beta;serine/threonine-protein kinase PAK 3;XLID30
- Extra Details:
- The protein encoded by this gene is a serine-threonine kinase and forms an activated complex with GTP-bound RAS-like (P21), CDC2 and RAC1. This protein may be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Defects in this gene are the cause of a non-syndromic form of X-linked intellectual disability. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Shipping Conditions:
- Blue Ice



