PAK3 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16942
Additional Names:: ARA|beta-PAK|bPAK|MRX30|MRX47|OPHN3|PAK-3|PAK3|PAK3beta|XLID30
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 80kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: MSDGLDNEEKPPAPPLRMNSNNRDSSALNHSSKPLPMAPEEKNKKARLRSIFPGGGDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGIPEQWAR
Uniprot:: O75914
Synonyms:: adriamycin resistance-associated;ARA;beta-PAK;bPAK;MRX30;MRX47;oligophrenin-3;OPHN3;p21 (CDKN1A)-activated kinase 3;p21 protein (Cdc42/Rac)-activated kinase 3;p21-activated kinase 3;PAK-3;PAK3beta;serine/threonine-protein kinase PAK 3;XLID30
Extra Details:: The protein encoded by this gene is a serine-threonine kinase and forms an activated complex with GTP-bound RAS-like (P21), CDC2 and RAC1. This protein may be necessary for dendritic development and for the rapid cytoskeletal reorganization in dendritic spines associated with synaptic plasticity. Defects in this gene are the cause of a non-syndromic form of X-linked intellectual disability. Alternatively spliced transcript variants encoding different isoforms have been identified.