NPAS2 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16930
Additional Names:: bHLHe9|MOP4|NPAS2|PASD4
Application:: ELISA, WB, IF, ICC
Molecular Weight:: 75kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequence:: KTTVLEKVIGFLQKHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
Uniprot:: Q99743
Synonyms:: basic-helix-loop-helix-PAS protein MOP4;bHLHe9;class E basic helix-loop-helix protein 9;member of PAS protein 4;member of PAS superfamily 4;MOP4;neuronal PAS domain-containing protein 2;neuronal PAS2;PAS domain-containing protein 4;PASD4
Extra Details:: The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a molecular clock operative in the mammalian forebrain.