A16926
NDUFS1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16926
- Additional Names:
- CI-75k|CI-75Kd|MC1DN5|NDUFS1|PRO1304
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- 75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- VEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKT
- Uniprot:
- P28331
- Synonyms:
- CI-75k;CI-75Kd;complex I 75kDa subunit;Complex I-75kD;complex I, mitochondrial respiratory chain, 75-kD subunit;MC1DN5;mitochondrial NADH-ubiquinone oxidoreductase 75 kDa subunit;NADH dehydrogenase (ubiquinone) Fe-S protein 1, 75kDa (NADH-coenzyme Q reductase);NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial;PRO1304
- Extra Details:
- The protein encoded by this gene belongs to the complex I 75 kDa subunit family. Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This protein is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized. Mutations in this gene are associated with complex I deficiency. Several transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice








