A16907
KPNA3 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16907
- Additional Names:
- hSRP1|IPOA4|KPNA3|SPG88|SRP1|SRP1gamma|SRP4
- Application:
- ELISA, WB
- Molecular Weight:
- 58kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- MAENPSLENHRIKSFKNKGRDVETMRRHRNEVTVELRKNKRDEHLLKKRNVPQEESLEDSDVDADFKAQNVTLEAILQNATSDNPVVQLSAVQAARKLLSSDRNPPIDDLIKSGILPILVKCLERDDNPSLQFEAAWALTNIASGTSAQTQAVVQSNAVPLFLRLLRSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISP
- Uniprot:
- O00505
- Synonyms:
- hSRP1;importin alpha 4;importin alpha Q2;importin alpha-3;importin subunit alpha-3;importin subunit alpha-4;IPOA4;karyopherin alpha 3 (importin alpha 4);Karyopherin subunit alpha-3;qip2;SRP1;SRP1-gamma;SRP1gamma;SRP4
- Extra Details:
- The transport of molecules between the nucleus and the cytoplasm in eukaryotic cells is mediated by the nuclear pore complex (NPC), which consists of 60-100 proteins. Small molecules (up to 70 kD) can pass through the nuclear pore by nonselective diffusion while larger molecules are transported by an active process. The protein encoded by this gene belongs to the importin alpha family, and is involved in nuclear protein import.
- Shipping Conditions:
- Blue Ice