A16906
KCNA1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16906
- Additional Names:
- AEMK|EA1|HBK1|HUK1|KCNA1|KV1.1|MBK1|MK1|RBK1
- Application:
- ELISA, WB, IF
- Molecular Weight:
- 60kDa/75kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTDV
- Uniprot:
- Q09470
- Synonyms:
- AEMK;EA1;HBK1;HUK1;KV1.1;MBK1;MK1;potassium channel, voltage gated shaker related subfamily A, member 1;potassium voltage-gated channel subfamily A member 1;potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia);RBK1;voltage-gated K(+) channel HuKI;voltage-gated potassium channel HBK1;voltage-gated potassium channel subunit Kv1.1
- Extra Details:
- This gene encodes a voltage-gated delayed potassium channel that is phylogenetically related to the Drosophila Shaker channel. The encoded protein has six putative transmembrane segments (S1-S6), and the loop between S5 and S6 forms the pore and contains the conserved selectivity filter motif (GYGD). The functional channel is a homotetramer. The N-terminus of the channel is associated with beta subunits that can modify the inactivation properties of the channel as well as affect expression levels. The C-terminus of the channel is complexed to a PDZ domain protein that is responsible for channel targeting. Mutations in this gene have been associated with myokymia with periodic ataxia (AEMK).
- Shipping Conditions:
- Blue Ice





