[KD Validated] LAMP1 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16894
Additional Names:: CD107a|LAMP1|LAMPA|LGP120
Application:: ELISA, WB, IHC-P, IF, ICC
Molecular Weight:: 42 kDa/90-120 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulation:: Unmodified
Sequence:: DKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHSEGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARDPAFKAANGSLRALQATVGNSYKCNAEEHVRVTKAFSVNIFKVWVQAFKVEGGQFGSVEECLLDENSMLIPIAVGGALAGLVLIV
Uniprot:: P11279
Synonyms:: CD107 antigen-like family member A;CD107a;LAMP-1;LAMPA;LGP120;lysosome-associated membrane glycoprotein 1;lysosome-associated membrane protein 1
Extra Details:: The protein encoded by this gene is a member of a family of membrane glycoproteins. This glycoprotein provides selectins with carbohydrate ligands. It may also play a role in tumor cell metastasis.