A16880
IFNA10 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16880
- Additional Names:
- IFN-alphaC|IFNA10
- Application:
- ELISA, WB
- Molecular Weight:
- 25kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW
- Uniprot:
- P01566
- Synonyms:
- IFN-alpha-10;IFN-alphaC;interferon alpha-10;interferon alpha-6L;interferon alpha-C;leIF C
- Extra Details:
- This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted.
- Shipping Conditions:
- Blue Ice