A1688
S100A8 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A1688
- Additional Names:
- 60B8AG|CAGA|CFAG|CGLA|CP-10|L1Ag|MA387|MIF|MRP8|NIF|P8|S100-A8|S100A8
- Application:
- ELISA, WB, IHC-P, IF
- Molecular Weight:
- 11kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulation:
- Unmodified
- Sequence:
- MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE
- Uniprot:
- P05109
- Synonyms:
- 60B8AG;CAGA;calgranulin A;Calgranulin-A;calprotectin L1L subunit;CFAG;CGLA;CP-10;cystic fibrosis antigen;L1Ag;leukocyte L1 complex light chain;MA387;MIF;migration inhibitory factor-related protein 8;MRP8;NIF;P8;protein S100-A8;S100 calcium-binding protein A8;S100-A8;urinary stone protein band A
- Extra Details:
- The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and as a cytokine. Altered expression of this protein is associated with the disease cystic fibrosis. Multiple transcript variants encoding different isoforms have been found for this gene.
- Shipping Conditions:
- Blue Ice





