A16879
HOXD9 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16879
- Additional Names:
- Hox-4.3|Hox-5.2|HOX4|HOX4C|HOXD9
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- VPPPPLAASASEPGRYVRSWMEPLPGFPGGAGGGGGGGGGGPGRGPSPGPSGPANGRHYGIKPETRAAPAPATAASTTSSSSTSLSSSSKRTECSVARESQ
- Uniprot:
- P28356
- Synonyms:
- homeo box D9;homeobox protein Hox-4C;homeobox protein Hox-5.2;homeobox protein Hox-D9;Hox-4.3;Hox-4.3, mouse, homolog of;Hox-5.2;HOX4;HOX4C
- Extra Details:
- This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The exact role of this gene has not been determined.
- Shipping Conditions:
- Blue Ice

