A16877
HOXD8 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16877
- Additional Names:
- HOX4|HOX4E|HOX5.4|HOXD8
- Application:
- ELISA, WB
- Molecular Weight:
- 32kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- RQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRMKWKKENNKDKFPVSRQEVKDGETKKEAQELEEDRAEGLTN
- Uniprot:
- P13378
- Synonyms:
- homeo box 4E;homeo box D8;homeobox protein 5.4;homeobox protein Hox-4E;homeobox protein Hox-5.4;homeobox protein Hox-D8;Hox-4.5;HOX4;HOX4E;HOX5.4
- Extra Details:
- This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5' end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function. Alternate splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice

