A16866
GNA15 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16866
- Additional Names:
- GNA15|GNA16|HG1L
- Application:
- ELISA, WB
- Molecular Weight:
- 43kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- HASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVRDSVLARYLDEINLL
- Uniprot:
- P30679
- Synonyms:
- epididymis secretory sperm binding protein;epididymis tissue protein Li 17E;g alpha-15;g alpha-16;G-protein subunit alpha-16;GNA16;guanine nucleotide binding protein (G protein), alpha 15 (Gq class);guanine nucleotide-binding protein subunit alpha-15;guanine nucleotide-binding protein subunit alpha-16
- Extra Details:
- Enables G protein-coupled receptor binding activity. Involved in positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway. Predicted to be located in plasma membrane. Predicted to be part of heterotrimeric G-protein complex.
- Shipping Conditions:
- Blue Ice

