GNA15 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16866
Additional Names:: GNA15|GNA16|HG1L
Application:: ELISA, WB
Molecular Weight:: 43kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: HASLVMSQDPYKVTTFEKRYAAAMQWLWRDAGIRACYERRREFHLLDSAVYYLSHLERITEEGYVPTAQDVLRSRMPTTGINEYCFSVQKTNLRIVDVGGQKSERKKWIHCFENVIALIYLASLSEYDQCLEENNQENRMKESLALFGTILELPWFKSTSVILFLNKTDILEEKIPTSHLATYFPSFQGPKQDAEAAKRFILDMYTRMYTGCVDGPEGSKKGARSRRLFSHYTCATDTQNIRKVFKDVRDSVLARYLDEINLL
Uniprot:: P30679
Synonyms:: epididymis secretory sperm binding protein;epididymis tissue protein Li 17E;g alpha-15;g alpha-16;G-protein subunit alpha-16;GNA16;guanine nucleotide binding protein (G protein), alpha 15 (Gq class);guanine nucleotide-binding protein subunit alpha-15;guanine nucleotide-binding protein subunit alpha-16
Extra Details:: Enables G protein-coupled receptor binding activity. Involved in positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway. Predicted to be located in plasma membrane. Predicted to be part of heterotrimeric G-protein complex.