Glucosylceramidase beta (GBA) Rabbit polyclonal antibody

Size

£152.00

SKU:: A16860
Additional Names:: GBA|GCB|GLUC|Glucosylceramidase beta (GBA)
Application:: ELISA, WB
Molecular Weight:: 60kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: ARPCIPKSFGYSSVVCVCNATYCDSFDPPTFPALGTFSRYESTRSGRRMELSMGPIQANHTGTGLLLTLQPEQKFQKVKGFGGAMTDAAALNILALSPPAQNLLLKSYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWAR
Uniprot:: P04062
Synonyms:: acid beta-glucosidase;alglucerase;beta-GC;beta-glucocerebrosidase;cholesterol glucosyltransferase;cholesteryl-beta-glucosidase;D-glucosyl-N-acylsphingosine glucohydrolase;GBA1;GCB;GLUC;glucocerebrosidase;glucosidase, beta, acid;glucosylceramidase-like protein;imiglucerase;lysosomal acid GCase;lysosomal acid glucosylceramidase;lysosomal glucocerebrosidase;SGTase
Extra Details:: This gene encodes a lysosomal membrane protein that cleaves the beta-glucosidic linkage of glycosylceramide, an intermediate in glycolipid metabolism. Mutations in this gene cause Gaucher disease, a lysosomal storage disease characterized by an accumulation of glucocerebrosides. A related pseudogene is approximately 12 kb downstream of this gene on chromosome 1. Alternative splicing results in multiple transcript variants.

Shipping Conditions:: Blue Ice