GAP43 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16857
Additional Names:: B-50|GAP-43|GAP43|PP46
Application:: ELISA, WB, IHC-P
Molecular Weight:: Refer to figures
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Uniprot:: P17677
Synonyms:: axonal membrane protein GAP-43;B-50;calmodulin-binding protein P-57;GAP-43;Growth-associated protein 43;nerve growth-related peptide GAP43;neural phosphoprotein B-50;neuromodulin;neuron growth-associated protein 43;PP46;protein F1
Extra Details:: The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.