A16851
FOXG1 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16851
- Additional Names:
- BF1|BF2|FHKL3|FKH2|FKHL1|FKHL2|FKHL3|FKHL4|FOXG1|FOXG1A|FOXG1B|FOXG1C|HBF-1|HBF-2|HBF-3|HBF-G2|HBF2|HFK1|HFK2|HFK3|KHL2|QIN
- Application:
- ELISA, WB
- Molecular Weight:
- 52kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- YSLNPCSVNLLAGQTSYFFPHVPHPSMTSQSSTSMSARAASSSTSPQAPSTLPCESLRPSLPSFTTGLSGGLSDYFTHQNQGSSSNPLIH
- Uniprot:
- P55316
- Synonyms:
- BF1;BF2;brain factor 1;brain factor 2;FHKL3;FKH2;FKHL1;FKHL2;FKHL3;FKHL4;forkhead box protein G1;Forkhead box protein G1A;Forkhead box protein G1B;Forkhead box protein G1C;forkhead-like 1;forkhead-like 2;forkhead-like 3;forkhead-like 4;Forkhead-related protein FKHL1;Forkhead-related protein FKHL2;Forkhead-related protein FKHL3;FOXG1A;FOXG1B;FOXG1C;HBF-1;HBF-2;HBF-3;HBF-G2;HBF2;HFK1;HFK2;HFK3;KHL2;oncogene QIN;QIN
- Extra Details:
- This locus encodes a member of the fork-head transcription factor family. The encoded protein, which functions as a transcriptional repressor, is highly expressed in neural tissues during brain development. Mutations at this locus have been associated with Rett syndrome and a diverse spectrum of neurodevelopmental disorders defined as part of the FOXG1 syndrome. This gene is disregulated in many types of cancer and is the target of multiple microRNAs that regulate the proliferation of tumor cells.
- Shipping Conditions:
- Blue Ice



