A16845
ETS2 Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16845
- Additional Names:
- ETS2|ETS2IT1
- Application:
- ELISA, WB
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- SSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA
- Uniprot:
- P15036
- Synonyms:
- ETS2IT1;oncogene ETS-2;protein C-ets-2;v-ets avian erythroblastosis virus E2 oncogene homolog 2;v-ets avian erythroblastosis virus E26 oncogene homolog 2;v-ets erythroblastosis virus E26 oncogene homolog 2
- Extra Details:
- This gene encodes a transcription factor which regulates genes involved in development and apoptosis. The encoded protein is also a protooncogene and shown to be involved in regulation of telomerase. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice