A16810
CD70 Rabbit polyclonal antibody

Size
£152.00
- SKU:
- A16810
- Additional Names:
- CD27-L|CD27L|CD27LG|CD70|LPFS3|TNFSF7|TNLG8A
- Application:
- ELISA, WB
- Molecular Weight:
- 27kDa
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- QLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASRHHPT
- Uniprot:
- P32970
- Synonyms:
- CD27 ligand;CD27-L;CD27L;CD27LG;CD70 antigen;Ki-24 antigen;LPFS3;surface antigen CD70;TNFSF7;TNLG8A;tumor necrosis factor ligand 8A;tumor necrosis factor ligand superfamily member 7
- Extra Details:
- The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
- Shipping Conditions:
- Blue Ice


_WB_01.jpg)
_WB_02.jpg)