CD86 Rabbit polyclonal antibody

Size

£152.00

SKU:: A16805
Additional Names:: B7-2|B7.2|B70|CD28LG2|CD86|LAB72
Application:: ELISA, WB, IF, ICC, IP
Molecular Weight:: 65-70 kDa
Species Reactivity:: Human
Purification:: Affinity Purified
Storage Conditions:: -20[o]C Avoid freeze/thaw cycles.
Supplier:: Abclonal
Host:: Rabbit
Reactivities:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequence:: PLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL
Uniprot:: P42081
Synonyms:: Activation B7-2 antigen;B-lymphocyte activation antigen B7-2;B7-2;B7.2;B70;BU63;CD28LG2;CD86 antigen (CD28 antigen ligand 2, B7-2 antigen);CTLA-4 counter-receptor B7.2;FUN-1;LAB72;T-lymphocyte activation antigen CD86
Extra Details:: This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.