A16799
CCKAR Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16799
- Additional Names:
- CCK-A|CCK1-R|CCK1R|CCKAR|CCKRA
- Application:
- ELISA, WB
- Molecular Weight:
- 42kda
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Mouse
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequence:
- IPNLLKDFIFGSAVCKTTTYFMGTSVSVSTFNLVAISLERYGAICKPLQSRVWQTKSHALKVIAATWCLSFTIMTPYPIYSNLVPFTKNNNQTANMCRFLL
- Uniprot:
- P32238
- Synonyms:
- CCK-A;CCK-A receptor;CCK-AR;CCK1-R;CCK1R;CCKRA;cholecystokinin receptor type A;cholecystokinin type-A receptor;cholecystokinin-1 receptor
- Extra Details:
- This gene encodes a G-protein coupled receptor that binds non-sulfated members of the cholecystokinin (CCK) family of peptide hormones. This receptor is a major physiologic mediator of pancreatic enzyme secretion and smooth muscle contraction of the gallbladder and stomach. In the central and peripheral nervous system this receptor regulates satiety and the release of beta-endorphin and dopamine.
- Shipping Conditions:
- Blue Ice