A16769
ATP5I Rabbit polyclonal antibody
Size
£152.00
- SKU:
- A16769
- Additional Names:
- ATP5I|ATP5K
- Application:
- ELISA, WB, IHC-P, IF, ICC
- Molecular Weight:
- Refer to figures
- Species Reactivity:
- Human
- Purification:
- Affinity Purified
- Storage Conditions:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Supplier:
- Abclonal
- Host:
- Rabbit
- Reactivities:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequence:
- MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
- Uniprot:
- P56385
- Synonyms:
- ATP synthase e chain, mitochondrial;ATP synthase subunit e, mitochondrial;ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E;ATP synthase, H+ transporting, mitochondrial Fo complex subunit E;ATP5I;ATP5K;ATPase subunit e;F1F0-ATP synthase, murine e subunit
- Extra Details:
- Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The F1 complex consists of 5 different subunits (alpha, beta, gamma, delta, and epsilon) assembled in a ratio of 3 alpha, 3 beta, and a single representative of the other 3. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the e subunit of the Fo complex. Alternative splicing results in multiple transcript variants.
- Shipping Conditions:
- Blue Ice